PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00106914001
Common NameGSBRNA2T00106914001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 262aa    MW: 29105.6 Da    PI: 7.1919
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00106914001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.3e-3078131155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00106914001  78 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 131
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05975134IPR017930Myb domain
SuperFamilySSF466892.24E-2075135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-3177136IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2479131IPR006447Myb domain, plants
PfamPF002499.1E-881130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MREEDSNWFA KWEEELPSPE ELIPLSQSLI TPDLAIAFDL RSPNQPQPQT TPPPQQTNSS  60
AEFAVDSAGA EPARTLKRPR LVWTPQLHKR FVDAVAHLGI KNAVPKTIMQ LMSVDGLTRE  120
NVASHLQKYR LYLKRMQSGG GGGGNVVGES DHLFASSPVP THFLHPTGRQ SSDHFIPSFV  180
PIASLQHHQP QFLHRQISAV NFTSQANNNN GKAMDQSLFL ARQSHHQQQQ QVLTRSQVAN  240
YADDLEQGAN TVLTLFPTRE N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-2177136463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.234170.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00106914001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737839.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9LTH42e-42PCLL_ARATH; Transcription factor BOA
TrEMBLA0A078ECC00.0A0A078ECC0_BRANA; BnaC09g50190D protein
STRINGBra009087.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15492791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.11e-98G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]